General Information

  • ID:  hor001860
  • Uniprot ID:  NA
  • Protein name:  Growth hormone-releasing factor
  • Gene name:  NA
  • Organism:  Bos taurus
  • Family:  Glucagon family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  NA
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQGAKVRL
  • Length:  42
  • Propeptide:  NA
  • Signal peptide:  NA
  • Modification:  T42 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001860_AF2.pdbhor001860_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 558308 Formula: C210H350N68O62S
Absent amino acids: CHPW Common amino acids: LQR
pI: 11.1 Basic residues: 8
Polar residues: 11 Hydrophobic residues: 14
Hydrophobicity: -72.62 Boman Index: -11486
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 88.33
Instability Index: 1834.05 Extinction Coefficient cystines: 2980
Absorbance 280nm: 72.68

Literature

  • PubMed ID:  6421287
  • Title:  Isolation and Characterization of the Bovine Hypothalamic Growth Hormone Releasing Factor